Rabbit TFPI protein

Product Overview

• Article Name: Rabbit TFPI protein
• Biozol Catalog Number: BYT-ORB605252
• Supplier Catalog Number: orb605252
• Alternative Catalog Number: BYT-ORB605252-20,BYT-ORB605252-100,BYT-ORB605252-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: (TFPI) (Extrinsic pathway inhibitor) (EPI) (Lipoprotein-associated coagulation inhibitor) (LACI)

Product Description

This Rabbit TFPI protein spans the amino acid sequence from region 25-300aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 35.4 kDa
• UniProt: P19761
• Buffer: Lyophilized from a 0.2 µm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
• Source: Oryctolagus cuniculus (Rabbit)
• Purity: Greater than 95% as determined by SDS-PAGE.
• Form: Lyophilized powder
• Sequence: AAEEDEEFTNITDIKPPLQKPTHSFCAMKVDDGPCRAYIKRFFFNILTHQCEEFIYGGCEGNENRFESLEECKEKCARDYPKMTTKLTFQKGKPDFCFLEEDPGICRGYITRYFYNNQSKQCERFKYGGCLGNLNNFESLEECKNTCENPTSDFQVDDHRTQLNTVNNTLINQPTKAPRRWAFHGPSWCLPPADRGLCQANEIRFFYNAIIGKCRPFKYSGCGGNENNFTSKKACITACKKGFIPKSIKGGLIKT

Application Notes

• Application Notes: Biological Origin: Oryctolagus cuniculus (Rabbit). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Rabbit TFPI at 1 µg/mL can bind Anti-TFPI recombinant antibody, the EC50 is 2.281-3.783 ng/mL. Application Notes: Full Length of Mature Protein

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized Rabbit TFPI at 1 µg/ml can bind Anti-TFPI recombinant antibody, the EC50 is 2.281-3.783 ng/mL.