Human CD274 protein

Produktübersicht

• Artikelname: Human CD274 protein
• Artikelnummer: BYT-ORB605286
• Hersteller Artikelnummer: orb605286
• Alternativnummer: BYT-ORB605286-20,BYT-ORB605286-100,BYT-ORB605286-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: PD-L1 (PDCD1 ligand 1) (Programmed death ligand 1) (hPD-L1) (B7 homolog 1) (B7-H1) (CD274)

Produktbeschreibung

This Human CD274 protein spans the amino acid sequence from region 19-238aa. Purity: Greater than 95% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 52.7 kDa
• UniProt: Q9NZQ7
• Puffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 95% as determined by SDS-PAGE.
• Formulierung: Lyophilized powder
• Sequenz: FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNER

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized PD-L1 at 2 µg/ml can bind Anti- PD-L1 mouse monoclonal antibody, the EC50 of human PD-L1 protein is 1.252-1.653 ng/mL. Application Notes: Extracellular Domain

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized PD-L1 at 2 µg/ml can bind Anti- PD-L1 mouse monoclonal antibody, the EC50 of human PD-L1 protein is 1.252-1.653 ng/mL.

The purity of CD274 was greater than 90% as determined by SEC-HPLC.