Human CD274 protein

Product Overview

• Article Name: Human CD274 protein
• Biozol Catalog Number: BYT-ORB605286
• Supplier Catalog Number: orb605286
• Alternative Catalog Number: BYT-ORB605286-20,BYT-ORB605286-100,BYT-ORB605286-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: PD-L1 (PDCD1 ligand 1) (Programmed death ligand 1) (hPD-L1) (B7 homolog 1) (B7-H1) (CD274)

Product Description

This Human CD274 protein spans the amino acid sequence from region 19-238aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 52.7 kDa
• UniProt: Q9NZQ7
• Buffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4
• Source: Homo sapiens (Human)
• Purity: Greater than 95% as determined by SDS-PAGE.
• Form: Lyophilized powder
• Sequence: FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNER

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized PD-L1 at 2 µg/ml can bind Anti- PD-L1 mouse monoclonal antibody, the EC50 of human PD-L1 protein is 1.252-1.653 ng/mL. Application Notes: Extracellular Domain

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized PD-L1 at 2 µg/ml can bind Anti- PD-L1 mouse monoclonal antibody, the EC50 of human PD-L1 protein is 1.252-1.653 ng/mL.

The purity of CD274 was greater than 90% as determined by SEC-HPLC.