Virus ftnA protein

Produktübersicht

• Artikelname: Virus ftnA protein
• Artikelnummer: BYT-ORB605327
• Hersteller Artikelnummer: orb605327
• Alternativnummer: BYT-ORB605327-20,BYT-ORB605327-100,BYT-ORB605327-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: pfr

Produktbeschreibung

This Virus ftnA protein spans the amino acid sequence from region 1-167aa. Purity: Greater than 85% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 21.8 kDa
• UniProt: P52093
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MLSKDIIKLLNEQVNKEMNSSNLYMSMSSWCYTHSLDGAGLFLFDHAAEEYEHAKKLIVFLNENNVPVQLTSISAPEHKFEGLTQIFQKAYEHEQHISESINNIVDHAIKGKDHATFNFLQWYVSEQHEEEVLFKDILDKIELIGNENHGLYLADQYVKGIAKSRKS

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori). Application Notes: Full length

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) ftnA.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) ftnA.