Virus ftnA protein

Product Overview

• Article Name: Virus ftnA protein
• Biozol Catalog Number: BYT-ORB605327
• Supplier Catalog Number: orb605327
• Alternative Catalog Number: BYT-ORB605327-20,BYT-ORB605327-100,BYT-ORB605327-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: pfr

Product Description

This Virus ftnA protein spans the amino acid sequence from region 1-167aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 21.8 kDa
• UniProt: P52093
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MLSKDIIKLLNEQVNKEMNSSNLYMSMSSWCYTHSLDGAGLFLFDHAAEEYEHAKKLIVFLNENNVPVQLTSISAPEHKFEGLTQIFQKAYEHEQHISESINNIVDHAIKGKDHATFNFLQWYVSEQHEEEVLFKDILDKIELIGNENHGLYLADQYVKGIAKSRKS

Application Notes

• Application Notes: Biological Origin: Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori). Application Notes: Full length

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) ftnA.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) ftnA.