Canine PNLIPRP1 protein

Produktübersicht

• Artikelname: Canine PNLIPRP1 protein
• Artikelnummer: BYT-ORB605368
• Hersteller Artikelnummer: orb605368
• Alternativnummer: BYT-ORB605368-20,BYT-ORB605368-100,BYT-ORB605368-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Short name, PL-RP1

Produktbeschreibung

Recombinant Dog Inactive pancreatic lipase-related protein 1(PNLIPRP1)

Produkteigenschaften

• Molekulargewicht: 51.7 kDa
• UniProt: P06857
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Canis lupus familiaris (Dog) (Canis familiaris)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: KEVCYEQIGCFSDAEPWAGTAIRPLKVLPWSPERIGTRFLLYTNKNPNNFQTLLPSDPSTIEASNFQTDKKTRFIIHGFIDKGEENWLLDMCKNMFKVEEVNCICVDWKKGSQTSYTQAANNVRVVGAQVAQMLSMLSANYSYSPSQVQLIGHSLGAHVAGEAGSRTPGLGRITGLDPVEASFQGTPEEVRLDPTDADFVDVIHTDAAPLIPFLGFGTSQQMGHLDFFPNGGEEMPGCKKNALSQIVDLDGIWEG

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Canis lupus familiaris (Dog) (Canis familiaris). Application Notes: Full Length of Mature Protein

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Canis lupus familiaris (Dog) (Canis familiaris) PNLIPRP1.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Canis lupus familiaris (Dog) (Canis familiaris) PNLIPRP1.