Canine PNLIPRP1 protein

Product Overview

• Article Name: Canine PNLIPRP1 protein
• Biozol Catalog Number: BYT-ORB605368
• Supplier Catalog Number: orb605368
• Alternative Catalog Number: BYT-ORB605368-20,BYT-ORB605368-100,BYT-ORB605368-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Short name, PL-RP1

Product Description

This Canine PNLIPRP1 protein spans the amino acid sequence from region 18-467aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 51.7 kDa
• UniProt: P06857
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Canis lupus familiaris (Dog) (Canis familiaris)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: KEVCYEQIGCFSDAEPWAGTAIRPLKVLPWSPERIGTRFLLYTNKNPNNFQTLLPSDPSTIEASNFQTDKKTRFIIHGFIDKGEENWLLDMCKNMFKVEEVNCICVDWKKGSQTSYTQAANNVRVVGAQVAQMLSMLSANYSYSPSQVQLIGHSLGAHVAGEAGSRTPGLGRITGLDPVEASFQGTPEEVRLDPTDADFVDVIHTDAAPLIPFLGFGTSQQMGHLDFFPNGGEEMPGCKKNALSQIVDLDGIWEG

Application Notes

• Application Notes: Biological Origin: Canis lupus familiaris (Dog) (Canis familiaris). Application Notes: Full Length of Mature Protein

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Canis lupus familiaris (Dog) (Canis familiaris) PNLIPRP1.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Canis lupus familiaris (Dog) (Canis familiaris) PNLIPRP1.