Porcine PSAP protein

Produktübersicht

• Artikelname: Porcine PSAP protein
• Artikelnummer: BYT-ORB605375
• Hersteller Artikelnummer: orb605375
• Alternativnummer: BYT-ORB605375-20,BYT-ORB605375-100,BYT-ORB605375-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Cerebroside sulfate activator (CS-ACT) (Non-specific activator) (Sphingolipid activator protein 1) (SAP-1)

Produktbeschreibung

This Porcine PSAP protein spans the amino acid sequence from region 1-80aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 11.9 kDa
• UniProt: P81405
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Sus scrofa (Pig)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: GDVCQDCIQMVTDLQNAVRTNSTFVEALVNHAKEECDRLGPGMADMCKNYISQYSEIAIQMMMHMQPKDICGLVGFCEEV

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Sus scrofa (Pig). Application Notes: Full Length

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Sus scrofa (Pig) PSAP.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Sus scrofa (Pig) PSAP.