Virus A27L protein
Artikelnummer:
BYT-ORB605429
- Bilder (3)
| Artikelname: | Virus A27L protein |
| Artikelnummer: | BYT-ORB605429 |
| Hersteller Artikelnummer: | orb605429 |
| Alternativnummer: | BYT-ORB605429-20,BYT-ORB605429-100,BYT-ORB605429-1 |
| Hersteller: | Biorbyt |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | A27L14 kDa fusion protein |
| This Virus A27L protein spans the amino acid sequence from region 1-110aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molekulargewicht: | 28.6 kDa |
| UniProt: | P20535 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Vaccinia virus (strain Copenhagen) (VACV) |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | MDGTLFPGDDDLAIPATEFFSTKADKKPEAKREAIVKADEDDNEETLKQRLTNLEKKITNVTTKFEQIEKCCKRNDEVLFRLENHAETLRAAMISLAKKIDVQTGRRPYE |
| Anwendungsbeschreibung: | Biological Origin: Vaccinia virus (strain Copenhagen) (VACV). Application Notes: Full Length |



