Virus A27L protein
Catalog Number:
BYT-ORB605429
- Images (3)
| Article Name: | Virus A27L protein |
| Biozol Catalog Number: | BYT-ORB605429 |
| Supplier Catalog Number: | orb605429 |
| Alternative Catalog Number: | BYT-ORB605429-20,BYT-ORB605429-100,BYT-ORB605429-1 |
| Manufacturer: | Biorbyt |
| Category: | Proteine/Peptide |
| Alternative Names: | A27L14 kDa fusion protein |
| This Virus A27L protein spans the amino acid sequence from region 1-110aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molecular Weight: | 28.6 kDa |
| UniProt: | P20535 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Vaccinia virus (strain Copenhagen) (VACV) |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MDGTLFPGDDDLAIPATEFFSTKADKKPEAKREAIVKADEDDNEETLKQRLTNLEKKITNVTTKFEQIEKCCKRNDEVLFRLENHAETLRAAMISLAKKIDVQTGRRPYE |
| Application Notes: | Biological Origin: Vaccinia virus (strain Copenhagen) (VACV). Application Notes: Full Length |
|
|
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. |
|
|
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Vaccinia virus (strain Copenhagen) (VACV) A27L. |
|
|
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Vaccinia virus (strain Copenhagen) (VACV) A27L. |
Product Guarantee and Expert Support
