Virus X protein

Produktübersicht

• Artikelname: Virus X protein
• Artikelnummer: BYT-ORB605527
• Hersteller Artikelnummer: orb605527
• Alternativnummer: BYT-ORB605527-20,BYT-ORB605527-100,BYT-ORB605527-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: HBx (Peptide X) (pX)

Produktbeschreibung

This Virus X protein spans the amino acid sequence from region 1-154aa. Purity: Greater than 85% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 18.1 kDa
• UniProt: Q9QMI3
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Hepatitis B virus genotype D subtype ayw (isolate Japan/JYW796/1988) (HBV-D)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKILHKRTLGLSTMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Hepatitis B virus genotype D subtype ayw (isolate Japan/JYW796/1988) (HBV-D). Application Notes: Full Length

Bilder

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Hepatitis B virus genotype D subtype ayw (isolate Japan/JYW796/1988) (HBV-D) X.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Hepatitis B virus genotype D subtype ayw (isolate Japan/JYW796/1988) (HBV-D) X.