Virus X protein

Product Overview

• Article Name: Virus X protein
• Biozol Catalog Number: BYT-ORB605527
• Supplier Catalog Number: orb605527
• Alternative Catalog Number: BYT-ORB605527-20,BYT-ORB605527-100,BYT-ORB605527-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: HBx (Peptide X) (pX)

Product Description

This Virus X protein spans the amino acid sequence from region 1-154aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 18.1 kDa
• UniProt: Q9QMI3
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Hepatitis B virus genotype D subtype ayw (isolate Japan/JYW796/1988) (HBV-D)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKILHKRTLGLSTMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA

Application Notes

• Application Notes: Biological Origin: Hepatitis B virus genotype D subtype ayw (isolate Japan/JYW796/1988) (HBV-D). Application Notes: Full Length

Images

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Hepatitis B virus genotype D subtype ayw (isolate Japan/JYW796/1988) (HBV-D) X.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Hepatitis B virus genotype D subtype ayw (isolate Japan/JYW796/1988) (HBV-D) X.