Hamster PRDX1 protein

Produktübersicht

• Artikelname: Hamster PRDX1 protein
• Artikelnummer: BYT-ORB605531
• Hersteller Artikelnummer: orb605531
• Alternativnummer: BYT-ORB605531-20,BYT-ORB605531-100,BYT-ORB605531-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Thioredoxin peroxidase 2 (TPX-2) (TDPX2)

Produktbeschreibung

This Hamster PRDX1 protein spans the amino acid sequence from region 2-199aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 24.2 kDa
• UniProt: Q9JKY1
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: SSGNAKIGYPAPNFKATAVMPDGQFRDICLSEYRGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWINTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITINDLPVGRSVDEILRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus). Application Notes: Full Length of Mature Protein

Bilder

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus) PRDX1.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus) PRDX1.