Hamster PRDX1 protein

Product Overview

• Article Name: Hamster PRDX1 protein
• Biozol Catalog Number: BYT-ORB605531
• Supplier Catalog Number: orb605531
• Alternative Catalog Number: BYT-ORB605531-20,BYT-ORB605531-100,BYT-ORB605531-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Thioredoxin peroxidase 2 (TPX-2) (TDPX2)

Product Description

This Hamster PRDX1 protein spans the amino acid sequence from region 2-199aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 24.2 kDa
• UniProt: Q9JKY1
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: SSGNAKIGYPAPNFKATAVMPDGQFRDICLSEYRGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWINTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITINDLPVGRSVDEILRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK

Application Notes

• Application Notes: Biological Origin: Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus). Application Notes: Full Length of Mature Protein

Images

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus) PRDX1.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus) PRDX1.