Human SARS coronavirus Spike glycoprotein(S) protein

Produktübersicht

• Artikelname: Human SARS coronavirus Spike glycoprotein(S) protein
• Artikelnummer: BYT-ORB668866
• Hersteller Artikelnummer: orb668866
• Alternativnummer: BYT-ORB668866-20,BYT-ORB668866-100,BYT-ORB668866-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: /

Produktbeschreibung

This Human SARS coronavirus Spike glycoprotein(S) protein spans the amino acid sequence from region 306-527aa. Purity: Greater than 95% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 30 kDa
• UniProt: P59594
• Puffer: Lyophilized from a 0.2 µm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
• Quelle: Severe acute respiratory syndrome coronavirus (SARS-CoV)
• Reinheit: Greater than 95% as determined by SDS-PAGE.
• Formulierung: Lyophilized powder
• Sequenz: RVVPSGDVVRFPNITNLCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFELLNAPATVCGPKLSTDLIKNQCVNF

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Severe acute respiratory syndrome coronavirus (SARS-CoV). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV S-RBD at 2 µg/ml can bind Paguma larvata ACE2, the EC50 is 5.056-7.559 ng/ml. ②Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV S-RBD at 5 µg/ml can bind human ACE2, the EC50 is 7.941-10.49 ng/ml. Application Notes: SARS-CoV-2 Related Proteins

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV S-RBD at 2 µg/ml can bind Paguma larvata ACE2, the EC50 is 5.056-7.559 ng/ml.

Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV S-RBD at 5 µg/ml can bind human ACE2, the EC50 is 7.941-10.49 ng/ml.