Human SARS coronavirus Spike glycoprotein(S) protein

Product Overview

• Article Name: Human SARS coronavirus Spike glycoprotein(S) protein
• Biozol Catalog Number: BYT-ORB668866
• Supplier Catalog Number: orb668866
• Alternative Catalog Number: BYT-ORB668866-20,BYT-ORB668866-100,BYT-ORB668866-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: /

Product Description

This Human SARS coronavirus Spike glycoprotein(S) protein spans the amino acid sequence from region 306-527aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 30 kDa
• UniProt: P59594
• Buffer: Lyophilized from a 0.2 µm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
• Source: Severe acute respiratory syndrome coronavirus (SARS-CoV)
• Purity: Greater than 95% as determined by SDS-PAGE.
• Form: Lyophilized powder
• Sequence: RVVPSGDVVRFPNITNLCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFELLNAPATVCGPKLSTDLIKNQCVNF

Application Notes

• Application Notes: Biological Origin: Severe acute respiratory syndrome coronavirus (SARS-CoV). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV S-RBD at 2 µg/ml can bind Paguma larvata ACE2, the EC50 is 5.056-7.559 ng/ml. ②Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV S-RBD at 5 µg/ml can bind human ACE2, the EC50 is 7.941-10.49 ng/ml. Application Notes: SARS-CoV-2 Related Proteins

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV S-RBD at 2 µg/ml can bind Paguma larvata ACE2, the EC50 is 5.056-7.559 ng/ml.

Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV S-RBD at 5 µg/ml can bind human ACE2, the EC50 is 7.941-10.49 ng/ml.