Severe acute respiratory syndrome coronavirus 2 Non-structural protein 9 protein

Produktübersicht

• Artikelname: Severe acute respiratory syndrome coronavirus 2 Non-structural protein 9 protein
• Artikelnummer: BYT-ORB668871
• Hersteller Artikelnummer: orb668871
• Alternativnummer: BYT-ORB668871-20,BYT-ORB668871-100,BYT-ORB668871-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Non-structural protein 9

Produktbeschreibung

This Severe acute respiratory syndrome coronavirus 2 Non-structural protein 9 protein spans the amino acid sequence from region 1-113aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 44.5 kDa
• UniProt: P0DTD1
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2). Application Notes: Coronavirus-Host Interactome Targets Proteins

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

The purity of nsp9 was greater than 95% as determined by SEC-HPLC