Severe acute respiratory syndrome coronavirus 2 Non-structural protein 9 protein

Product Overview

• Article Name: Severe acute respiratory syndrome coronavirus 2 Non-structural protein 9 protein
• Biozol Catalog Number: BYT-ORB668871
• Supplier Catalog Number: orb668871
• Alternative Catalog Number: BYT-ORB668871-20,BYT-ORB668871-100,BYT-ORB668871-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Non-structural protein 9

Product Description

This Severe acute respiratory syndrome coronavirus 2 Non-structural protein 9 protein spans the amino acid sequence from region 1-113aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 44.5 kDa
• UniProt: P0DTD1
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ

Application Notes

• Application Notes: Biological Origin: Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2). Application Notes: Coronavirus-Host Interactome Targets Proteins

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

The purity of nsp9 was greater than 95% as determined by SEC-HPLC