Human coronavirus NL63 Nucleo protein

Produktübersicht

• Artikelname: Human coronavirus NL63 Nucleo protein
• Artikelnummer: BYT-ORB705018
• Hersteller Artikelnummer: orb705018
• Alternativnummer: BYT-ORB705018-20,BYT-ORB705018-100,BYT-ORB705018-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Nucleocapsid protein Short name: NC Short name: Protein N

Produktbeschreibung

Recombinant Human coronavirus NL63 Nucleoprotein(N)

Produkteigenschaften

• Molekulargewicht: 46.3 kDa
• UniProt: Q6Q1R8
• Puffer: Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
• Quelle: Human coronavirus NL63 (HCoV-NL63)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Lyophilized powder
• Sequenz: MASVNWADDRAARKKFPPPSFYMPLLVSSDKAPYRVIPRNLVPIGKGNKDEQIGYWNVQERWRMRRGQRVDLPPKVHFYYLGTGPHKDLKFRQRSDGVVWVAKEGAKTVNTSLGNRKRNQKPLEPKFSIALPPELSVVEFEDRSNNSSRASSRSSTRNNSRDSSRSTSRQQSRTRSDSNQSSSDLVAAVTLALKNLGFDNQSKSPSSSGTSTPKKPNKPLSQPRADKPSQLKKPRWKRVPTREENVIQCFGPRDF

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Human coronavirus NL63 (HCoV-NL63). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference