Human coronavirus NL63 Nucleo protein

Product Overview

• Article Name: Human coronavirus NL63 Nucleo protein
• Biozol Catalog Number: BYT-ORB705018
• Supplier Catalog Number: orb705018
• Alternative Catalog Number: BYT-ORB705018-20,BYT-ORB705018-100,BYT-ORB705018-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Nucleocapsid protein Short name: NC Short name: Protein N

Product Description

Recombinant Human coronavirus NL63 Nucleoprotein(N)

Product Properties

• Molecular Weight: 46.3 kDa
• UniProt: Q6Q1R8
• Buffer: Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
• Source: Human coronavirus NL63 (HCoV-NL63)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Lyophilized powder
• Sequence: MASVNWADDRAARKKFPPPSFYMPLLVSSDKAPYRVIPRNLVPIGKGNKDEQIGYWNVQERWRMRRGQRVDLPPKVHFYYLGTGPHKDLKFRQRSDGVVWVAKEGAKTVNTSLGNRKRNQKPLEPKFSIALPPELSVVEFEDRSNNSSRASSRSSTRNNSRDSSRSTSRQQSRTRSDSNQSSSDLVAAVTLALKNLGFDNQSKSPSSSGTSTPKKPNKPLSQPRADKPSQLKKPRWKRVPTREENVIQCFGPRDF

Application Notes

• Application Notes: Biological Origin: Human coronavirus NL63 (HCoV-NL63). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.