Human ACKR1 protein

Artikelnummer: BYT-ORB705321
Artikelname: Human ACKR1 protein
Artikelnummer: BYT-ORB705321
Hersteller Artikelnummer: orb705321
Alternativnummer: BYT-ORB705321-100,BYT-ORB705321-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Duffy antigen/chemokine receptor Fy glycoprotein Short name: GpFy Glycoprotein D Plasmodium vivax receptor CD_antigen: CD234 DARC, FY, GPD
This Human ACKR1 protein spans the amino acid sequence from region 1-336aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molekulargewicht: 41.1 kDa
UniProt: Q16570
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MGNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYGANLEAAAPCHSCNLLDDSALPFFILTSVLGILASSTVLFMLFRPLFRWQLCPGWPVLAQLAVGSALFSIVVPVLAPGLGSTRSSALCSLGYCVWYGSAFAQALLLGCHASLGHRLGAGQVPGLTLGLTVGIWGVAALLTLPVTLASGASGGLCTLIYSTELKALQATHTVACLAIFVLLPLGLFGAKGLKKALGMGPGPWMNILWAWFIFWWP
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized ACKR1 at 1 µg/ml can bind human CCL2, the EC50 of human CCL2 protein is 48.64-60.24 µg/ml. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
Measured by its binding ability in a functional ELISA. Immobilized ACKR1 at 1 µg/ml can bind human CCL2, the EC50 of human CCL2 protein is 48.64-60.24 µg/ml.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.