Human ACKR1 protein

Product Overview

• Article Name: Human ACKR1 protein
• Biozol Catalog Number: BYT-ORB705321
• Supplier Catalog Number: orb705321
• Alternative Catalog Number: BYT-ORB705321-100,BYT-ORB705321-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Duffy antigen/chemokine receptor Fy glycoprotein Short name: GpFy Glycoprotein D Plasmodium vivax receptor CD_antigen: CD234 DARC, FY, GPD

Product Description

This Human ACKR1 protein spans the amino acid sequence from region 1-336aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 41.1 kDa
• UniProt: Q16570
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Homo sapiens (Human)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MGNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYGANLEAAAPCHSCNLLDDSALPFFILTSVLGILASSTVLFMLFRPLFRWQLCPGWPVLAQLAVGSALFSIVVPVLAPGLGSTRSSALCSLGYCVWYGSAFAQALLLGCHASLGHRLGAGQVPGLTLGLTVGIWGVAALLTLPVTLASGASGGLCTLIYSTELKALQATHTVACLAIFVLLPLGLFGAKGLKKALGMGPGPWMNILWAWFIFWWP

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized ACKR1 at 1 µg/ml can bind human CCL2, the EC50 of human CCL2 protein is 48.64-60.24 µg/ml. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference

Images

Measured by its binding ability in a functional ELISA. Immobilized ACKR1 at 1 µg/ml can bind human CCL2, the EC50 of human CCL2 protein is 48.64-60.24 µg/ml.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.