Human ACE2 protein

Produktübersicht

• Artikelname: Human ACE2 protein
• Artikelnummer: BYT-ORB705345
• Hersteller Artikelnummer: orb705345
• Alternativnummer: BYT-ORB705345-20,BYT-ORB705345-100,BYT-ORB705345-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: /

Produktbeschreibung

Recombinant Human Angiotensin-converting enzyme 2(ACE2),partial

Produkteigenschaften

• Molekulargewicht: 112.6kDa
• UniProt: Q9BYF1
• Puffer: Lyophilized from a 0.2 µm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Lyophilized powder
• Sequenz: QSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPDNPQECLLLEPGLNEIMANSLDYNERLWAWESWRSEVGKQLRPLYEEYVVLKNEMARANHYEDYGDYWRGDYEVNGVDGYDYSRGQLIEDVEHTFEEIKPLYEHLHAYVRAKLMNAYPSYISPIGCLPAHLLGDMWG

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S1-RBD at 2 µg/ml can bind Biotinylated human ACE2, the EC50 is 4.599-8.322 ng/ml. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference