Human ACE2 protein

Catalog Number: BYT-ORB705345
Article Name: Human ACE2 protein
Biozol Catalog Number: BYT-ORB705345
Supplier Catalog Number: orb705345
Alternative Catalog Number: BYT-ORB705345-20,BYT-ORB705345-100,BYT-ORB705345-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: /
This Human ACE2 protein spans the amino acid sequence from region 18-740. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 112.6 kDa
UniProt: Q9BYF1
Buffer: Lyophilized from a 0.2 µm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Lyophilized powder
Sequence: QSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPDNPQECLLLEPGLNEIMANSLDYNERLWAWESWRSEVGKQLRPLYEEYVVLKNEMARANHYEDYGDYWRGDYEVNGVDGYDYSRGQLIEDVEHTFEEIKPLYEHLHAYVRAKLMNAYPSYISPIGCLPAHLLGDMWG
Application Notes: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S1-RBD at 2 µg/ml can bind Biotinylated human ACE2, the EC50 is 4.599-8.322 ng/ml. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S1-RBD at 2 µg/ml can bind Biotinylated human ACE2, the EC50 is 4.599-8.322 ng/ml.