SARS-CoV-2 NSP9/SARS Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB738433
Artikelname: SARS-CoV-2 NSP9/SARS Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB738433
Hersteller Artikelnummer: orb738433
Alternativnummer: BYT-ORB738433-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA
Spezies Reaktivität: Human
Immunogen: NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ
Konjugation: Unconjugated
Alternative Synonym: Replicase polyprotein 1ab, pp1ab, ORF1ab polyprotein, nsp10, Non-structural protein 10, Growth factor-like peptide, GFL, rep, sars-cov-2
Anti-SARS-CoV-2 NSP9 Antibody. Tested in ELISA applications. This antibody reacts with Human.
Klonalität: Polyclonal
Konzentration: 500 µg/ml
Molekulargewicht: 140 kDa, 130 kDa, 110 kDa
UniProt: P0DTC1
Puffer: Each vial contains 4mg Trehalose, 0.9mg NaCl and 0.2mg Na2HPO4.
Formulierung: Lyophilized
Target-Kategorie: Glutamate receptor 1
Application Verdünnung: ELISA, 0.001-0.1µg/ml, Human