SARS-CoV-2 NSP9/SARS Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB738433
| Article Name: |
SARS-CoV-2 NSP9/SARS Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB738433 |
| Supplier Catalog Number: |
orb738433 |
| Alternative Catalog Number: |
BYT-ORB738433-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
ELISA |
| Species Reactivity: |
Human |
| Immunogen: |
NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ |
| Conjugation: |
Unconjugated |
| Alternative Names: |
Replicase polyprotein 1ab, pp1ab, ORF1ab polyprotein, nsp10, Non-structural protein 10, Growth factor-like peptide, GFL, rep, sars-cov-2 |
| Anti-SARS-CoV-2 NSP9 Antibody. Tested in ELISA applications. This antibody reacts with Human. |
| Clonality: |
Polyclonal |
| Concentration: |
500 µg/ml |
| Molecular Weight: |
140 kDa, 130 kDa, 110 kDa |
| UniProt: |
P0DTC1 |
| Buffer: |
Each vial contains 4mg Trehalose, 0.9mg NaCl and 0.2mg Na2HPO4. |
| Form: |
Lyophilized |
| Target: |
Glutamate receptor 1 |
| Application Dilute: |
ELISA, 0.001-0.1µg/ml, Human |