Bacterial dps protein

Produktübersicht

• Artikelname: Bacterial dps protein
• Artikelnummer: BYT-ORB8134
• Hersteller Artikelnummer: orb8134
• Alternativnummer: BYT-ORB8134-1,BYT-ORB8134-100,BYT-ORB8134-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Bacterioferritin HP-NAP Neutrophil-activating protein A Short name, NAP A

Produktbeschreibung

This Bacterial dps protein spans the amino acid sequence from region 1-144aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 32.9 kDa
• UniProt: P43313
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MKTFEILKHLQADAIVLFMKVHNFHWNVKGTDFFNVHKATEEIYEEFADMFDDLAERIVQLGHHPLVTLSEAIKLTRVKEETKTSFHSKDIFKEILEDYKYLEKEFKELSNTAEKEGDKVTVTYADDQLAKLQKSIWMLQAHLA

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori). Application Notes: Tag info: N-terminal 6xHis-SUMO-taggedExpression Region: 1-144aaSequence Info: Full LengthGlycerol content: 0.5

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) dps.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) dps.