Bacterial dps protein

Product Overview

• Article Name: Bacterial dps protein
• Biozol Catalog Number: BYT-ORB8134
• Supplier Catalog Number: orb8134
• Alternative Catalog Number: BYT-ORB8134-1,BYT-ORB8134-100,BYT-ORB8134-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Bacterioferritin HP-NAP Neutrophil-activating protein A Short name, NAP A

Product Description

This Bacterial dps protein spans the amino acid sequence from region 1-144aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 32.9 kDa
• UniProt: P43313
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MKTFEILKHLQADAIVLFMKVHNFHWNVKGTDFFNVHKATEEIYEEFADMFDDLAERIVQLGHHPLVTLSEAIKLTRVKEETKTSFHSKDIFKEILEDYKYLEKEFKELSNTAEKEGDKVTVTYADDQLAKLQKSIWMLQAHLA

Application Notes

• Application Notes: Biological Origin: Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori). Application Notes: Tag info: N-terminal 6xHis-SUMO-taggedExpression Region: 1-144aaSequence Info: Full LengthGlycerol content: 0.5

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) dps.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) dps.