Bacterial ail protein

Produktübersicht

• Artikelname: Bacterial ail protein
• Artikelnummer: BYT-ORB8160
• Hersteller Artikelnummer: orb8160
• Alternativnummer: BYT-ORB8160-1,BYT-ORB8160-100,BYT-ORB8160-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: ailAttachment invasion locus protein

Produktbeschreibung

This Bacterial ail protein spans the amino acid sequence from region 24-178aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 33.2 kDa
• UniProt: P16454
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yersinia enterocolitica
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: ASESSISIGYAQSHVKENGYTLDNDPKGFNLKYRYELDDNWGVIGSFAYTHQGYDFFYGSNKFGHGDVDYYSVTMGPSFRINEYVSLYGLLGAAHGKVKASVFDESISASKTSMAYGAGVQFNPLPNFVIDASYEYSKLDSIKVGTWMLGAGYRF

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Yersinia enterocolitica. Application Notes: Tag info: N-terminal 6xHis-SUMO-taggedExpression Region: 24-178aaSequence Info: Full Length of Mature ProteinGlycerol content: 0.5

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Yersinia enterocoliticaail.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Yersinia enterocoliticaail.