Bacterial ail protein

Product Overview

• Article Name: Bacterial ail protein
• Biozol Catalog Number: BYT-ORB8160
• Supplier Catalog Number: orb8160
• Alternative Catalog Number: BYT-ORB8160-1,BYT-ORB8160-100,BYT-ORB8160-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: ailAttachment invasion locus protein

Product Description

This Bacterial ail protein spans the amino acid sequence from region 24-178aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 33.2 kDa
• UniProt: P16454
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Yersinia enterocolitica
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: ASESSISIGYAQSHVKENGYTLDNDPKGFNLKYRYELDDNWGVIGSFAYTHQGYDFFYGSNKFGHGDVDYYSVTMGPSFRINEYVSLYGLLGAAHGKVKASVFDESISASKTSMAYGAGVQFNPLPNFVIDASYEYSKLDSIKVGTWMLGAGYRF

Application Notes

• Application Notes: Biological Origin: Yersinia enterocolitica. Application Notes: Tag info: N-terminal 6xHis-SUMO-taggedExpression Region: 24-178aaSequence Info: Full Length of Mature ProteinGlycerol content: 0.5

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Yersinia enterocoliticaail.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Yersinia enterocoliticaail.