Human CCR8 protein

Produktübersicht

• Artikelname: Human CCR8 protein
• Artikelnummer: BYT-ORB865263
• Hersteller Artikelnummer: orb865263
• Alternativnummer: BYT-ORB865263-1,BYT-ORB865263-100,BYT-ORB865263-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: (CC chemokine receptor CHEMR1) (CMKBRL2) (Chemokine receptor-like 1) (CKR-L1) (GPR-CY6) (GPRCY6) (TER1) (CDw198) (CKRL1) (CMKBR8) (CMKBRL2)

Produktbeschreibung

This Human CCR8 protein spans the sequence from region 1-355aa.

Produkteigenschaften

• Molekulargewicht: 42.2 kDa
• UniProt: P51685
• Puffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4.
• Quelle: Homo sapiens (Human)
• Formulierung: Lyophilized powder
• Sequenz: MDYTLDLSVTTVTDYYYPDIFSSPCDAELIQTNGKLLLAVFYCLLFVFSLLGNSLVILVLVVCKKLRSITDVYLLNLALSDLLFVFSFPFQTYYLLDQWVFGTVMCKVVSGFYYIGFYSSMFFITLMSVDRYLAVVHAVYALKVRTIRMGTTLCLAVWLTAIMATIPLLVFYQVASEDGVLQCYSFYNQQTLKWKIFTNFKMNILGLLIPFTIFMFCYIKILHQLKRCQNHNKTKAIRLVLIVVIASLLFWVPFN

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized human CCR8 at 5 µg/ml can bind Anti-CCR8 recombinant Antibody, the the EC50 is 11.13-17.29 ng/ml. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing

Bilder

WB analysis of is detected by Mouse anti-6*His monoclonal antibody using Human CCR8 protein

Detected by Mouse anti-6*His monoclonal antibody.

Detected by Anti-CCR8 recombinant Antibody

Measured by its binding ability in a functional ELISA. Immobilized human CCR8 at 5 µg/ml can bind Anti-CCR8 recombinant Antibody, the the EC50 is 11.13-17.29 ng/ml.

The presence of VLP-like structures was confirmed by TEM

Loaded Anti-Human CCR8 Antibody on 96-Flat plate, can bind Human CCR8, with an affinity constant of <1 pM as determined in BLI assay (Gator Prime).

The purity of VLPs was greater than 90% as determined by SEC-HPLC