Human CCR8 protein
Catalog Number:
BYT-ORB865263
- Images (7)
| Article Name: | Human CCR8 protein |
| Biozol Catalog Number: | BYT-ORB865263 |
| Supplier Catalog Number: | orb865263 |
| Alternative Catalog Number: | BYT-ORB865263-1,BYT-ORB865263-100,BYT-ORB865263-20 |
| Manufacturer: | Biorbyt |
| Category: | Proteine/Peptide |
| Alternative Names: | (CC chemokine receptor CHEMR1) (CMKBRL2) (Chemokine receptor-like 1) (CKR-L1) (GPR-CY6) (GPRCY6) (TER1) (CDw198) (CKRL1) (CMKBR8) (CMKBRL2) |
| This Human CCR8 protein spans the sequence from region 1-355aa. |
| Molecular Weight: | 42.2 kDa |
| UniProt: | P51685 |
| Buffer: | Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4. |
| Source: | Homo sapiens (Human) |
| Form: | Lyophilized powder |
| Sequence: | MDYTLDLSVTTVTDYYYPDIFSSPCDAELIQTNGKLLLAVFYCLLFVFSLLGNSLVILVLVVCKKLRSITDVYLLNLALSDLLFVFSFPFQTYYLLDQWVFGTVMCKVVSGFYYIGFYSSMFFITLMSVDRYLAVVHAVYALKVRTIRMGTTLCLAVWLTAIMATIPLLVFYQVASEDGVLQCYSFYNQQTLKWKIFTNFKMNILGLLIPFTIFMFCYIKILHQLKRCQNHNKTKAIRLVLIVVIASLLFWVPFN |
| Application Notes: | Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized human CCR8 at 5 µg/ml can bind Anti-CCR8 recombinant Antibody, the the EC50 is 11.13-17.29 ng/ml. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing |







