Recombinant Human Beta-nerve growth factor (NGF) (Active)

Artikelnummer: CSB-AP003771HU
Artikelname: Recombinant Human Beta-nerve growth factor (NGF) (Active)
Artikelnummer: CSB-AP003771HU
Hersteller Artikelnummer: CSB-AP003771HU
Alternativnummer: CSB-AP003771HU-1, CSB-AP003771HU-500, CSB-AP003771HU-50, CSB-AP003771HU-10
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Beta-Nerve Growth Factor, Beta-NGF, NGF, NGFB
Molekulargewicht: 13.4 kDa
Tag: Tag-Free
UniProt: P01138
Puffer: Lyophilized from a 0.2 µm sterile filtered PBS, PH7.4.
Quelle: E.coli
Expression System: 122-241aa
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Lyophilized powder
Sequenz: SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.