Recombinant Human Beta-nerve growth factor (NGF) (Active)
Artikelnummer:
CSB-AP003771HU
| Artikelname: |
Recombinant Human Beta-nerve growth factor (NGF) (Active) |
| Artikelnummer: |
CSB-AP003771HU |
| Hersteller Artikelnummer: |
CSB-AP003771HU |
| Alternativnummer: |
CSB-AP003771HU-1, CSB-AP003771HU-500, CSB-AP003771HU-50, CSB-AP003771HU-10 |
| Hersteller: |
Cusabio |
| Kategorie: |
Proteine/Peptide |
| Alternative Synonym: |
Beta-Nerve Growth Factor, Beta-NGF, NGF, NGFB |
| Molekulargewicht: |
13.4 kDa |
| Tag: |
Tag-Free |
| UniProt: |
P01138 |
| Puffer: |
Lyophilized from a 0.2 µm sterile filtered PBS, PH7.4. |
| Quelle: |
E.coli |
| Expression System: |
122-241aa |
| Reinheit: |
Greater than 95% as determined by SDS-PAGE. |
| Formulierung: |
Lyophilized powder |
| Sequenz: |
SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA |
|
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. |