Recombinant Human Beta-nerve growth factor (NGF) (Active)

Catalog Number: CSB-AP003771HU
Article Name: Recombinant Human Beta-nerve growth factor (NGF) (Active)
Biozol Catalog Number: CSB-AP003771HU
Supplier Catalog Number: CSB-AP003771HU
Alternative Catalog Number: CSB-AP003771HU-1, CSB-AP003771HU-500, CSB-AP003771HU-50, CSB-AP003771HU-10
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Beta-Nerve Growth Factor, Beta-NGF, NGF, NGFB
Molecular Weight: 13.4 kDa
Tag: Tag-Free
UniProt: P01138
Buffer: Lyophilized from a 0.2 µm sterile filtered PBS, PH7.4.
Source: E.coli
Expression System: 122-241aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Lyophilized powder
Sequence: SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.