Recombinant Human Thrombopoietin (THPO) (Active)

Artikelnummer: CSB-AP003971HU
Artikelname: Recombinant Human Thrombopoietin (THPO) (Active)
Artikelnummer: CSB-AP003971HU
Hersteller Artikelnummer: CSB-AP003971HU
Alternativnummer: CSB-AP003971HU-1, CSB-AP003971HU-500, CSB-AP003971HU-50, CSB-AP003971HU-10
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Thrombopoietin,C-mpl ligand,Megakaryocyte colony-stimulating factor,Megakaryocyte growth and development factor,Myeloproliferative leukemia virus oncogene ligand,THPO
Molekulargewicht: 37.3 kDa
Tag: N-terminal 6xHis-tagged and C-terminal 6xHis-tagged
UniProt: P40225
Puffer: Lyophilized from a 0.2 µm filtered 20 mM Tris-HCl, 150 mM NaCl, pH 8.0
Quelle: Mammalian cell
Expression System: 22-353aa
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Lyophilized powder
Sequenz: SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISS