Recombinant Human Thrombopoietin (THPO) (Active)
Catalog Number:
CSB-AP003971HU
| Article Name: |
Recombinant Human Thrombopoietin (THPO) (Active) |
| Biozol Catalog Number: |
CSB-AP003971HU |
| Supplier Catalog Number: |
CSB-AP003971HU |
| Alternative Catalog Number: |
CSB-AP003971HU-1, CSB-AP003971HU-500, CSB-AP003971HU-50, CSB-AP003971HU-10 |
| Manufacturer: |
Cusabio |
| Category: |
Proteine/Peptide |
| Alternative Names: |
Thrombopoietin,C-mpl ligand,Megakaryocyte colony-stimulating factor,Megakaryocyte growth and development factor,Myeloproliferative leukemia virus oncogene ligand,THPO |
| Molecular Weight: |
37.3 kDa |
| Tag: |
N-terminal 6xHis-tagged and C-terminal 6xHis-tagged |
| UniProt: |
P40225 |
| Buffer: |
Lyophilized from a 0.2 µm filtered 20 mM Tris-HCl, 150 mM NaCl, pH 8.0 |
| Source: |
Mammalian cell |
| Expression System: |
22-353aa |
| Purity: |
Greater than 95% as determined by SDS-PAGE. |
| Form: |
Lyophilized powder |
| Sequence: |
SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISS |
|
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. |