Recombinant Human Hyaluronan and proteoglycan link protein 2 (HAPLN2)

Artikelnummer: CSB-BP010131HU
Artikelname: Recombinant Human Hyaluronan and proteoglycan link protein 2 (HAPLN2)
Artikelnummer: CSB-BP010131HU
Hersteller Artikelnummer: CSB-BP010131HU
Alternativnummer: CSB-BP010131HU-1, CSB-BP010131HU-100, CSB-BP010131HU-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Brain link protein 1 (BRAL1)
Molekulargewicht: 37.2 kDa
Tag: N-terminal 10xHis-tagged
UniProt: Q9GZV7
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Baculovirus
Expression System: 27-340aa
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: DPASHPGPHYLLPPIHEVIHSHRGATATLPCVLGTTPPSYKVRWSKVEPGELRETLILITNGLHARGYGPLGGRARMRRGHRLDASLVIAGVRLEDEGRYRCELINGIEDESVALTLSLEGVVFPYQPSRGRYQFNYYEAKQACEEQDGRLATYSQLYQAWTEGLDWCNAGWLLEGSVRYPVLTARAPCGGRGRPGIRSYGPRDRMRDRYDAFCFTSALAGQVFFVPGRLTLSEAHAACRRRGAVVAKVGHLYAA
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.