Recombinant Human Hyaluronan and proteoglycan link protein 2 (HAPLN2)

Catalog Number: CSB-BP010131HU
Article Name: Recombinant Human Hyaluronan and proteoglycan link protein 2 (HAPLN2)
Biozol Catalog Number: CSB-BP010131HU
Supplier Catalog Number: CSB-BP010131HU
Alternative Catalog Number: CSB-BP010131HU-1, CSB-BP010131HU-100, CSB-BP010131HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Brain link protein 1 (BRAL1)
Molecular Weight: 37.2 kDa
Tag: N-terminal 10xHis-tagged
UniProt: Q9GZV7
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Baculovirus
Expression System: 27-340aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: DPASHPGPHYLLPPIHEVIHSHRGATATLPCVLGTTPPSYKVRWSKVEPGELRETLILITNGLHARGYGPLGGRARMRRGHRLDASLVIAGVRLEDEGRYRCELINGIEDESVALTLSLEGVVFPYQPSRGRYQFNYYEAKQACEEQDGRLATYSQLYQAWTEGLDWCNAGWLLEGSVRYPVLTARAPCGGRGRPGIRSYGPRDRMRDRYDAFCFTSALAGQVFFVPGRLTLSEAHAACRRRGAVVAKVGHLYAA
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.