Recombinant Human Histidine--tRNA ligase, cytoplasmic (HARS1), partial

Artikelnummer: CSB-BP010137HU
Artikelname: Recombinant Human Histidine--tRNA ligase, cytoplasmic (HARS1), partial
Artikelnummer: CSB-BP010137HU
Hersteller Artikelnummer: CSB-BP010137HU
Alternativnummer: CSB-BP010137HU-1, CSB-BP010137HU-100, CSB-BP010137HU-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Histidyl-tRNA synthetase
Molekulargewicht: 58.7 kDa
Tag: N-terminal 6xHis-tagged
UniProt: P12081
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Baculovirus
Expression System: 2-504aa
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: AERAALEELVKLQGERVRGLKQQKASAELIEEEVAKLLKLKAQLGPDESKQKFVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMNKLTNIKRYHIAKVYRRDNPAMTRGRYREFYQCDFDIAGNFDPMIPDAECLKIMCEILSSLQIGDFLVKVNDRRILDGMFAICGVSDSKFRTICSSVDKLDKVSWEEVKNEMVGE
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.