Recombinant Human Histidine--tRNA ligase, cytoplasmic (HARS1), partial

Catalog Number: CSB-BP010137HU
Article Name: Recombinant Human Histidine--tRNA ligase, cytoplasmic (HARS1), partial
Biozol Catalog Number: CSB-BP010137HU
Supplier Catalog Number: CSB-BP010137HU
Alternative Catalog Number: CSB-BP010137HU-1, CSB-BP010137HU-100, CSB-BP010137HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Histidyl-tRNA synthetase
Molecular Weight: 58.7 kDa
Tag: N-terminal 6xHis-tagged
UniProt: P12081
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Baculovirus
Expression System: 2-504aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: AERAALEELVKLQGERVRGLKQQKASAELIEEEVAKLLKLKAQLGPDESKQKFVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMNKLTNIKRYHIAKVYRRDNPAMTRGRYREFYQCDFDIAGNFDPMIPDAECLKIMCEILSSLQIGDFLVKVNDRRILDGMFAICGVSDSKFRTICSSVDKLDKVSWEEVKNEMVGE
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.