Recombinant Human HLA class I histocompatibility antigen, alpha chain G (HLA-G)

Produktübersicht

• Artikelname: Recombinant Human HLA class I histocompatibility antigen, alpha chain G (HLA-G)
• Artikelnummer: CSB-BP010509HU(F5)
• Hersteller Artikelnummer: CSB-BP010509HU(F5)
• Alternativnummer: CSB-BP010509HU(F5)-1, CSB-BP010509HU(F5)-100, CSB-BP010509HU(F5)-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: (HLA G antigen)(MHC class I antigen G)

Produkteigenschaften

• Molekulargewicht: 53.1 kDa
• Tag: C-terminal 10xHis-tagged
• UniProt: P17693
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Baculovirus
• Expression System: 25-319aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: GSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQ

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.