Recombinant Human HLA class I histocompatibility antigen, alpha chain G (HLA-G)

Catalog Number: CSB-BP010509HU(F5)
Article Name: Recombinant Human HLA class I histocompatibility antigen, alpha chain G (HLA-G)
Biozol Catalog Number: CSB-BP010509HU(F5)
Supplier Catalog Number: CSB-BP010509HU(F5)
Alternative Catalog Number: CSB-BP010509HU(F5)-1, CSB-BP010509HU(F5)-100, CSB-BP010509HU(F5)-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: (HLA G antigen)(MHC class I antigen G)
Molecular Weight: 53.1 kDa
Tag: C-terminal 10xHis-tagged
UniProt: P17693
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Baculovirus
Expression System: 25-319aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: GSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQ
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.