Recombinant Bovine albumin (ALB)

Artikelnummer: CSB-EP001561BOA0
Artikelname: Recombinant Bovine albumin (ALB)
Artikelnummer: CSB-EP001561BOA0
Hersteller Artikelnummer: CSB-EP001561BOa0
Alternativnummer: CSB-EP001561BOA0-1, CSB-EP001561BOA0-100, CSB-EP001561BOA0-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: BSA
Molekulargewicht: 73.4 kDa
Tag: N-terminal 6xHis-tagged
UniProt: P02769
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.187.
Quelle: E.coli
Expression System: 25-607aa
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: DTHKSEIAHRFKDLGEEHFKGLVLIAFSQYLQQCPFDEHVKLVNELTEFAKTCVADESHAGCEKSLHTLFGDELCKVASLRETYGDMADCCEKQEPERNECFLSHKDDSPDLPKLKPDPNTLCDEFKADEKKFWGKYLYEIARRHPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPKIETMREKVLASSARQRLRCASIQKFGERALKAWSVARLSQKFPKAEFVEVTKLVTDLTKVHKECCHGDLLECADD
Anwendungsbeschreibung: Research Areas: Cardiovascular