Recombinant Bovine albumin (ALB)

Catalog Number: CSB-EP001561BOA0
Article Name: Recombinant Bovine albumin (ALB)
Biozol Catalog Number: CSB-EP001561BOA0
Supplier Catalog Number: CSB-EP001561BOa0
Alternative Catalog Number: CSB-EP001561BOA0-1, CSB-EP001561BOA0-100, CSB-EP001561BOA0-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: BSA
Molecular Weight: 73.4 kDa
Tag: N-terminal 6xHis-tagged
UniProt: P02769
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.187.
Source: E.coli
Expression System: 25-607aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: DTHKSEIAHRFKDLGEEHFKGLVLIAFSQYLQQCPFDEHVKLVNELTEFAKTCVADESHAGCEKSLHTLFGDELCKVASLRETYGDMADCCEKQEPERNECFLSHKDDSPDLPKLKPDPNTLCDEFKADEKKFWGKYLYEIARRHPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPKIETMREKVLASSARQRLRCASIQKFGERALKAWSVARLSQKFPKAEFVEVTKLVTDLTKVHKECCHGDLLECADD
Application Notes: Research Areas: Cardiovascular