Recombinant Human CDGSH iron-sulfur domain-containing protein 3, mitochondrial (CISD3)

Artikelnummer: CSB-EP005444HU
Artikelname: Recombinant Human CDGSH iron-sulfur domain-containing protein 3, mitochondrial (CISD3)
Artikelnummer: CSB-EP005444HU
Hersteller Artikelnummer: CSB-EP005444HU
Alternativnummer: CSB-EP005444HU-1, CSB-EP005444HU-100, CSB-EP005444HU-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: MitoNEET-related protein 2,Mitochondrial inner NEET protein
Molekulargewicht: 19.7 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P0C7P0
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Expression System: 15-127aa
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: ARDLNPRRDISSWLAQWFPRTPARSVVALKTPIKVELVAGKTYRWCVCGRSKKQPFCDGSHFFQRTGLSPLKFKAQETRMVALCTCKATQRPPYCDGTHRSERVQKAEVGSPL
Anwendungsbeschreibung: Research Areas: Cancer. Endotoxin: Not test