Recombinant Human CDGSH iron-sulfur domain-containing protein 3, mitochondrial (CISD3)

Catalog Number: CSB-EP005444HU
Article Name: Recombinant Human CDGSH iron-sulfur domain-containing protein 3, mitochondrial (CISD3)
Biozol Catalog Number: CSB-EP005444HU
Supplier Catalog Number: CSB-EP005444HU
Alternative Catalog Number: CSB-EP005444HU-1, CSB-EP005444HU-100, CSB-EP005444HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: MitoNEET-related protein 2,Mitochondrial inner NEET protein
Molecular Weight: 19.7 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P0C7P0
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 15-127aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: ARDLNPRRDISSWLAQWFPRTPARSVVALKTPIKVELVAGKTYRWCVCGRSKKQPFCDGSHFFQRTGLSPLKFKAQETRMVALCTCKATQRPPYCDGTHRSERVQKAEVGSPL
Application Notes: Research Areas: Cancer. Endotoxin: Not test