Recombinant Bovine pro-epidermal growth factor (EGF), partial

Artikelnummer: CSB-EP007473BO
Artikelname: Recombinant Bovine pro-epidermal growth factor (EGF), partial
Artikelnummer: CSB-EP007473BO
Hersteller Artikelnummer: CSB-EP007473BO
Alternativnummer: CSB-EP007473BO-1, CSB-EP007473BO-100, CSB-EP007473BO-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Molekulargewicht: 12.8 kDa
Tag: C-terminal 6xHis-tagged
UniProt: XP_024849546.1
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.104.
Quelle: E.coli
Expression System: 971-1023aa
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: DSTLLSHLGKNGHNFLKKCFPEYTPNFEGYCLNGHVCIYFGIANLFSCHCPIG
Anwendungsbeschreibung: Research Areas: Signal transduction