Recombinant Bovine pro-epidermal growth factor (EGF), partial

Catalog Number: CSB-EP007473BO
Article Name: Recombinant Bovine pro-epidermal growth factor (EGF), partial
Biozol Catalog Number: CSB-EP007473BO
Supplier Catalog Number: CSB-EP007473BO
Alternative Catalog Number: CSB-EP007473BO-1, CSB-EP007473BO-100, CSB-EP007473BO-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Molecular Weight: 12.8 kDa
Tag: C-terminal 6xHis-tagged
UniProt: XP_024849546.1
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.104.
Source: E.coli
Expression System: 971-1023aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: DSTLLSHLGKNGHNFLKKCFPEYTPNFEGYCLNGHVCIYFGIANLFSCHCPIG
Application Notes: Research Areas: Signal transduction