Recombinant Human Free fatty acid receptor 2 (FFAR2), partial

Artikelnummer: CSB-EP008605HU1
Artikelname: Recombinant Human Free fatty acid receptor 2 (FFAR2), partial
Artikelnummer: CSB-EP008605HU1
Hersteller Artikelnummer: CSB-EP008605HU1
Alternativnummer: CSB-EP008605HU1-1, CSB-EP008605HU1-100, CSB-EP008605HU1-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: G-protein coupled receptor 43
Molekulargewicht: 38.1 kDa
Tag: N-terminal 6xHis-GST-tagged
UniProt: O15552
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.89.
Quelle: E.coli
Expression System: 277-330aa
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: SSVVRRAFGRGLQVLRNQGSSLLGRRGKDTAEGTNEDRGVGQGEGMPSSDFTTE
Anwendungsbeschreibung: Research Areas: Metabolism