Recombinant Human Free fatty acid receptor 2 (FFAR2), partial

Catalog Number: CSB-EP008605HU1
Article Name: Recombinant Human Free fatty acid receptor 2 (FFAR2), partial
Biozol Catalog Number: CSB-EP008605HU1
Supplier Catalog Number: CSB-EP008605HU1
Alternative Catalog Number: CSB-EP008605HU1-1, CSB-EP008605HU1-100, CSB-EP008605HU1-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: G-protein coupled receptor 43
Molecular Weight: 38.1 kDa
Tag: N-terminal 6xHis-GST-tagged
UniProt: O15552
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.89.
Source: E.coli
Expression System: 277-330aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: SSVVRRAFGRGLQVLRNQGSSLLGRRGKDTAEGTNEDRGVGQGEGMPSSDFTTE
Application Notes: Research Areas: Metabolism